Plinkett video compilations

The funniest moments from everyone's favorite movie reviewer, RedLetterMedia's Harry ... Posted by: JediFan421 Video duration: 864 seconds Global video hits: 18241 The funniest moments from everyone's favorite movie reviewer, RedLetterMedia's Harry S. Plinkett, voiced by Mike Stoklasa and portrayed by Rich Evans. All material produced at redlettermedia.com Related: redlettermedia, harry, plinkett, star, wars, review, the, phantom, menace, attack, of, clones, revenge, sith, babys, day, out, trek, mike, stoklasa, rich, evans, jedi, darth, vader, clone, lightsaber, force Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: I was disappointed ... By: SuperHeroMania. on 23 May 12, 03:47:45 I was disappointed he though Star Trek First Contact was bad, that was the only film I disagreed with? him ... By: superstarmc1. on 20 May 12, 21:17:32 Euyuyujjtggyyyyuhhyyyiuyyyyyuyyttptttytpppppyoprpppppprrrpppppppprppplfllppordrooorogopsddufdgxgupprggohfkklllllllppppooopyrrllpplipqlllllallllpplwrppptaafafafryroptlyutyhlkiiiitrfdhffdfff? I wasn't yelling ... By: halo6534. on 20 May 12, 08:30:31 I wasn't yelling at? you.....i know what your comment ment. I was just telling you my opinion on it. Did I say I liked ... By: KLADDKAKA1985. on 20 May 12, 01:19:38 Did I say I liked it? I just told you that he did a positive review about avatar. Keep your? adhd in check. Avatar? was such a ... By: halo6534. on 19 May 12, 10:57:04 Avatar? was such a gay, retarded, overrated piece of shit. Never before had i watched such a CLICHE, PREDICTABLE, BORING, UNINSPIRED, BAD CASTED movie. Grossing almost 3 billion dollars, i was expecting a masterpiece, but got a shitsterpiece. Gay voiced plinkett ... By: The1AndOnlyDannyBro. on 17 May 12, 04:54:01 Gay voiced plinkett is the best? plinkett. Browns and? BEIIIGE! By: darthzach. on 09 May 12, 09:45:31 Browns and? BEIIIGE! And Rick Astley, ... By: satsunada. on 04 May 12, 11:41:52 And Rick Astley, and Rick Rude, and Ric Flair, and Rickets,? and Rick Moranis, and Rick Hoffman Brown and Beiggggge ... By: SeeYouNextTuesday0. on 03 May 12, 23:08:41 Brown and Beiggggge.? 59 minutes? !!!! By: LondonCrusader. on 03 May 12, 03:22:21 59 minutes? !!!! Hey, remember that ... By: The1AndOnlyDannyBro. on 30 Apr 12, 05:16:20 Hey, remember that scene in SW Episode three, after they save Palpatine, Anakin says something about saving Ben for the 10th time, and Ben says 9th time? He a really awkward line and shifty eyes when saying that other stuff doesn't count. Everytime I see this? scene, I think of that scene in Pulp Fiction. You know, the one with that black guy and the thing is his mouth while he's getting... *cough*... and that guy walks in with a sword and... Yeah. I think that's what happened. Fifffty niiine ... By: BlarkUntVhite. on 22 Apr 12, 12:22:50 Fifffty niiine minnnuuuuutes~ ? (?____?) What's the name of ... By: Cgrazi18. on 20 Apr 12, 01:02:37 What's the name of this guys channel? He, didnt seem to ... By: KLADDKAKA1985. on 17 Apr 12, 05:21:33 He, didnt seem to mind avatar.? I'm going to do a ... By: JediFan421. on 13 Apr 12, 14:27:50 I'm going to do a best of Rich Evans including his Plinkett stuff soon. ? I was expecting all ... By: nsomestuph. on 13 Apr 12, 07:37:07 I was expecting all of the plinket? videos into one but this will do i guess. Making a best of ... By: Feratrox. on 10 Apr 12, 17:18:21 Making a best of Plinkett seems impossible since there's just so much great stuff he's done. You pretty much nailed it though, except for the ending to his Phantom Menace review about the scene he found to be the strangest.... You all? saw that right? Which fired a ... By: silarnon. on 08 Apr 12, 09:59:32 Which fired a little ball of light which? ... went off like a teeny fire cracker. What the fuck? The phasers small enough to fit into your hand can EVAPORATE AN ENTIRE PERSON. And a BAZOOKA only explodes an itty bitty rock?!?! FUCK. how did you? get ... By: Jay21L. on 07 Apr 12, 11:37:27 how did you? get the episode III review clips? So then Worf had a ... By: behrooz4. on 02 Apr 12, 03:18:51 So then Worf had a purple? space bazooka... you may have heard ... By: Buffalodriver87. on 31 Mar 12, 23:07:51 you may have heard of it, it was this? little thing called WORLD WAR ONE!!! My name's Rick, and ... By: richardmoores. on 28 Mar 12, 12:58:04 My name's Rick, and I? ruin everything too! yeah Astley is ... By: jmiester25. on 27 Mar 12, 16:02:56 yeah Astley is actually good? at what he does hahah :p He only? reviews ... By: JediFan421. on 26 Mar 12, 21:29:58 He only? reviews bad movies though... (except for Star Trek 2009) i vvant him to do? ... By: najsbajsmedmajs. on 26 Mar 12, 19:40:56 i vvant him to do? a pulp fiction revvievv! Mr. Plinkett: animated series #1 Posted by: 789Films789 Video duration: 163 seconds Global video hits: 37768 For Mike Stoklasa of Redlettermedia and the (fingerscrossed) public domain/un-copyrighte d Harry S. Plinkett. Star Wars Blu-ray coming to a store near you= can't wait! 789films789. Adventures of the Blue Car. Half in the Bag. Star Trek the next generation. Related: redlettermedia, adventures of the blue car, animated, cartoon, mr. plinkett, nadine, mike stoklasa, review, new, half in the bag, justin bieber, tyt, coast to coast am Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: Please stop the ... By: CaptainPositron. on 03 May 12, 22:28:51 Please stop the film's pulsating, its making me seasick!? :r Worf's? purple ... By: Gallifrey1991. on 24 Apr 12, 11:38:00 Worf's? purple space bazooka what is? that song ... By: nintfjr. on 26 Mar 12, 05:01:59 what is? that song that plays at the beginnning? Surprised Tasha Yar ... By: compwiz101. on 03 Mar 12, 03:21:59 Surprised Tasha Yar picture? = Win wow, i've seen this ... By: Compn1. on 26 Feb 12, 21:39:54 wow, i've seen this a few times and for some reason? never got the cat part until now. The best part is at ... By: ThePizztanoShow. on 23 Feb 12, 03:51:22 The best part is at 1:35 lol!? I lost it at? the ... By: TheInflicted. on 10 Feb 12, 14:13:56 I lost it at? the purple space bazooka. "its the feds.. ... By: spaxspore. on 09 Feb 12, 21:11:25 "its the feds.. hold on" Why does that? always make me laugh... This is? better ... By: scottg4520. on 16 Jan 12, 21:57:57 This is? better than the movies. I love this it ... By: mineofilms. on 14 Jan 12, 06:30:57 I love this it really captures what RLM is all? about.... these are doubly ... By: crinoid1919. on 13 Jan 12, 23:16:06 these are doubly funny if you have seen all his reviews! Warfs? purple bazooka :D yeah, scan it, then ... By: 789Films789. on 13 Jan 12, 22:33:38 yeah, scan it, then colour it in by mouse.? Do you? draw this ... By: Anarchist86ed. on 13 Jan 12, 14:41:25 Do you? draw this by hand? Southern Cross in? ... By: noitcurtsnocnacnuD. on 13 Jan 12, 14:05:37 Southern Cross in? the background during the Enterprise fly-by :) Lmaooo "come with ... By: beavisandbutthead104. on 13 Jan 12, 13:11:20 Lmaooo "come with me and? youll be in a world of imagination." This video is rad these? are hilarious By: nerdelicious5. on 13 Jan 12, 06:54:11 these? are hilarious The data quarters ... By: spaxspore. on 10 Jan 12, 01:03:01 The data quarters thing was taken from TNG? interactive CD ROM Tour. All in old ass quicktime 2.0-3.0 ish.? Boy that takes me back I just realized the ... By: Wizardington. on 05 Jan 12, 03:58:30 I just realized the poster seems to say "Revenge of? the Tshi" when Picard is there. This is the most ... By: topperheartramada. on 04 Jan 12, 17:53:35 This is the most important? video ever made. Purple space ... By: kasrkinmullet. on 22 Dec 11, 18:16:27 Purple space bazooka XD ? W? O W By: nickismindbullets. on 21 Dec 11, 05:34:44 W? O W Star? Trek + ... By: xPureEx. on 20 Dec 11, 14:52:39 Star? Trek + Ghostbusters music = I think I came inside my shorts a few dozen times. I was a little on ... By: Spo8. on 18 Dec 11, 22:18:42 I was a little on the fence until the cat loving. Then I was so far on your side of the fence that I couldn't even see the fence anymore. Plinkett is? all we could ever hope to be. full? of epic and ... By: diogeneslaertius666. on 10 Dec 11, 14:13:09 full? of epic and wins Mr. Plinkett Updates and More! Posted by: RedLetterMedia Video duration: 127 seconds Global video hits: 58441 www.redlettermedia.c om and the great Plinkett auction http Related: plinkett, red, letter, media Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: Your selling out ... By: cgrazi pmnine. on 21 Apr 12, 22:30:43 Your selling out like Jorge Lucas why? doesn't he get a fucking miror Yeeeessssss.? I ... By: MrBuch169169. on 13 Mar 12, 15:04:39 Yeeeessssss.? I like the flavor packets.... if they had the ' ... By: IINesasta. on 19 Feb 12, 18:26:58 if they had the 'where in the? money' song playing somewhere over this, it'd have been perfect Dear Mr Plinkett, ... By: ArcanePath360. on 28 Nov 11, 11:22:22 Dear Mr Plinkett, please stop with HITB, it's a waste of your talent and? our time. Please? resume with your EPIC reviews and bring happiness back to the people!!!!!!!!!!!!!!!!!!!!!!!!­!!!!!!! hilarious? By: LookOutForDetoxx. on 12 Oct 11, 15:47:43 hilarious? the "oh" in the ... By: fressfisch. on 01 Oct 11, 21:22:38 the "oh" in the end? was not long enough, ooc, man For those ... By: YesWeCantaloupe. on 29 Sep 11, 16:00:44 For those unfamiliar with Red Letter Media, I highly recommend "Half in the Bag" movie reviews. They're pretty good. It'll keep your mind at ease while you're banging your head against the wall? waiting endlessly for the next Plinkett review. the video version ... By: mightlife. on 24 Sep 11, 10:00:37 the video version of Plinkett is just not the same (I don't mean physically, that would be too hard) - the voice is a bit of a let down in? the kinematograph version. Palpatine is dead! Long live Plinkett. More reviews please :) Remember...an ... By: cooldude333. on 10 Jun 11, 16:38:00 Remember...an incredibly RARE popcorn tub!? 1:21? By: WetzelPretzelz. on 22 Apr 11, 22:24:56 1:21? i cried? when ... By: AJ100885. on 21 Apr 11, 10:31:56 i cried? when palpatine died Omg i didn't? see ... By: Mrhellsy. on 13 Apr 11, 23:16:10 Omg i didn't? see this one! @LivesForJihad ... By: Fredcheesburger. on 07 Apr 11, 00:17:40 @LivesForJihad That's what I'd hoped for. Good catch,? too. Yeah, that was my ... By: LivesForJihad. on 06 Apr 11, 23:48:41 Yeah, that was my comment. He must of deleted it. I thumbed your comment!? Lets get it back to the top! I miss that one top ... By: Fredcheesburger. on 30 Mar 11, 21:58:59 I miss that one top comment that? says to click on 1:22 to hear Palpatine say "dick". you must all ways ... By: TheInspector3000. on 30 Mar 11, 21:26:51 you must all ways get drunk before recorded these audio clips, your not as slured in real life, also, for such? a creepy bacement, your upstairs is not so bad, well not since george broke in... @ ... By: terratrema. on 30 Mar 11, 19:33:46 @SequentiallyCompact No.? what is the update ... By: achiapet44. on 29 Mar 11, 13:39:22 what is the update r? u really dieing Well it IS a ... By: ig88bc. on 23 Mar 11, 22:24:58 Well it IS a Titanic popcorn tub. AND it was in a popular internet review of a popular film. AND? people paid thousands for Shatner's kidney stone. See you at the ... By: Utubeblows. on 14 Mar 11, 15:05:22 See you at the comic con this weekend, Im in the booth behind? you and Im coming by to get my goddamned pizza rolls signed I WANT MY FRICKIN ... By: 909sickle. on 14 Mar 11, 03:37:32 I WANT MY FRICKIN PIZZA ROLLS!!!!!! YOU? OWE ME SO MANY!!! It's a piece? of ... By: Curttehmurt. on 13 Mar 11, 03:47:53 It's a piece? of history! leathery skinned ... By: 911TVify. on 12 Mar 11, 22:30:01 leathery skinned asshole LOL XD? Anyone think? ... By: SequentiallyCompact. on 12 Mar 11, 16:58:17 Anyone think? they're setting up Nadine to continue reviews in Plinkett's place? Here is a good ... By: TheStatus2x. on 12 Mar 11, 05:17:49 Here is a good update, The Episode III Review Epilogue is now up on his web zone and can? be summed up in four letters E.P.I.C! Mr. Plinkett's recap of the prequels Posted by: IrishRoo12 Video duration: 236 seconds Global video hits: 8123 Taken from the Episode III review. Redlettermedia.com Related: plinkett, star wars Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: My? favorite part ... By: RisingVictor. on 08 May 12, 01:45:11 My? favorite part was "and then you saw the movie. Oohh....." I always lol'd at that part. Props sir? =) By: Scarecrow545. on 02 May 12, 18:35:50 Props sir? =) there's a hidden ... By: garignacful. on 27 Apr 12, 02:28:57 there's a hidden joke that i'm not sure anyone noticed but i've always gotten a kick out of: "even starving african children in cambodia" cambodia is in southeast? asia If you simply ... By: jheadSF06. on 14 Apr 12, 23:27:49 If you simply rearrange the letters of the word, you can spell out a different word which predicted that the movie would be: TSHI which is Chinese for disappointed in? the cooking of the duck meat. So fucking hilarious! XD I'm going to go to ... By: RomanLettore. on 14 Apr 12, 19:54:35 I'm going to go to Africa and help build schools for Cambodian children this? summer! best part:? 2:10 By: chadmann999. on 12 Apr 12, 18:33:42 best part:? 2:10 ...have you watched ... By: mechanixis. on 08 Apr 12, 17:49:52 ...have you watched the clip?? Uh... okay. Well, ... By: andreasgutten. on 08 Apr 12, 16:30:43 Uh... okay. Well, try to point out your point next time then, since it was LASER SWORD and not the fact he thought everyone wanted to see Yoda pull out? a lightsaber . So your argument is ... By: mechanixis. on 07 Apr 12, 23:13:41 So your argument is "if everything was completely different, everything would be completely different." Plinkett explains pretty clearly why Yoda using a lightsaber, under any circumstances, pretty much contradicts the entirety of his character from the original trilogy. But you're missing my point. The point is that George Lucas, the creator of Star Wars, the supposed mastermind and craftsman of the Star? Wars saga, calls a lightsaber a "laser sword." No, It's not. ... By: andreasgutten. on 07 Apr 12, 20:06:10 No, It's not. Everyone would've loved Yoda using a lightsaber if the prequels were awesome and well done. Then everyone? would be "Okay, I suppose that's neat". everybody's gonna ... By: jmiester25. on 27 Mar 12, 15:58:51 everybody's gonna wear? earth tones cause they live on a planet! It's? alright, #1.. ... By: Crymson1. on 26 Mar 12, 06:27:59 It's? alright, #1... I know what will make this all better: pizza rolls! Earth tones, people ... By: behrooz4. on 26 Mar 12, 03:41:03 Earth tones, people! Earth tones! Browns and beige and browns and? beige and browns and beige Why was this cable ... By: Crymson1. on 21 Mar 12, 16:33:48 Why was this cable system in place. And, more importantly, why were there stuntmen disguised as Baku, and why were they practicing during a town emergency? They should have been helping people escape, and not rehearsing? for their gig at Universal Studios. So then Worf had? a ... By: behrooz4. on 07 Mar 12, 23:42:18 So then Worf had? a purple space bazooka...oh wait, wrong movie Any movie with a ... By: Sphynra. on 07 Mar 12, 18:50:45 Any movie with a plot that can't stand for itself? is shitty, so the expanded universe deal makes thing even worse. I know, why are ... By: ATENakaATON. on 05 Mar 12, 23:37:03 I know, why are you? informing me of this? trade federation ... By: gethsoftware. on 05 Mar 12, 21:20:40 trade federation had no reason to do what ever they did. or atleast theri motivations where not explained at all. instead it just says taxes and does not specify who is taxed, what was taxed, and how? this is any how does invading naboo or declearing a war help them in this proplem. You can argue that ... By: mechanixis. on 07 Feb 12, 22:02:52 You can argue that George Lucas is a visionary and an artist and that the Star Wars prequels are rich, intentionally-designed vehicles for meaning and drama. All of that is undone by the five-second clip of? George Lucas saying, "Then Yoda whips out his little laser sword, because, y'know, that's what everyone's waiting to see." So what you're ... By: mechanixis. on 07 Feb 12, 22:00:07 So what you're saying is,? you don't need to watch Plinkett's review in order to dismiss his criticisms, but the rest of us need to read the Expanded Universe materials before we dismiss Star Wars I-III as poorly written films. Name calling is a ... By: slintirreg. on 07 Feb 12, 16:10:07 Name calling is a pretty smooth form of argument eh? Saves you time a lot of time. When you haven't watched it how can you even try to defend the prequels, if you don't know? the accusations/arguments against it? And don't give us the "someone wrote a 23457 pages rebuttal"-crap. That it has some volume doesn't mean its any good. And besides that: that a film has underlying symbolic messages doesn't mean it is any good as a movie. Nice lil recap!! ... By: WhiteMagicEnygma. on 16 Jan 12, 06:40:49 Nice lil recap!! Some times/people need their SW's Prequel/Plinkett fill? without watching like 30 parts of indepth (&very true/accurate) analysis what fallacies?? ... By: jurassicturd3. on 18 Dec 11, 20:20:19 what fallacies?? what strawmen arguements? idiot? By: jurassicturd3. on 18 Dec 11, 20:18:50 idiot? at 2:10? I was ... By: EinsteinEMP826. on 29 Nov 11, 13:16:57 at 2:10? I was waiting for "what's wrong with your FACE??" Mr. Plinkett: Cop Dog Review - Cats Posted by: PJI93 Video duration: 114 seconds Global video hits: 3000 A rather funny segment from Mr. Plinkett's Cop Dog review where he talks about cats in movies and things typically take a trip down insanity lane. Related: mr, plinkett, redlettermedia, red, letter, media, cop, dog, review Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: you will tell the ... By: SuperMrMaximo. on 09 May 12, 02:17:27 you will tell the doctors what you are doing. no no not now im making the? cooking video What? the hell. ... By: ddd3fb. on 06 May 12, 20:30:13 What? the hell. Wrong with you! It? also killed his ... By: SephirothsStudent. on 02 Feb 12, 01:53:33 It? also killed his cat XD Beyond fucked up... ... By: Titant2. on 18 Jan 12, 15:31:43 Beyond fucked up... Love it? XD I literally chocked ... By: Malaikat31. on 11 Jan 12, 23:03:49 I literally chocked repetedly from the laughter. The circular saw scene killed? me. fuck this made me ... By: 41gagavision. on 23 Nov 11, 03:46:25 fuck this made me laugh , while he? was reviewing cop dog....LOL hahahaha And now back to Cop ... By: venom11808. on 16 Oct 11, 02:49:07 And now back to Cop Dog.? Dear Mr. Plinkett... Posted by: mark84j Video duration: 108 seconds Global video hits: 7935 A letter to my favorite internet reviewer. Related: red, letter, media, mr, mister, plinkett, star, wars, review, attack, of, the, clones, phantom, menace, thank, you, sir Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: hahaha, very ... By: ohcalcutta81. on 05 Jan 12, 05:25:38 hahaha, very fitting tribute? to Mr. Plinkett. I'm 7000 :)? By: Murdoc113. on 28 Dec 11, 12:01:08 I'm 7000 :)? Plinkett isn't ... By: WelcomeGhostsIV. on 04 Dec 11, 01:43:48 Plinkett isn't doing Half In The Bag, Mike and Jay are. Also it fucking? rules! Dear? Mr Plinkett, ... By: ArcanePath360. on 28 Nov 11, 11:21:25 Dear? Mr Plinkett, please stop with HITB, it's a waste of your talent and our time. Please resume with your EPIC reviews and bring happiness back to the people!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! and this is why we ... By: fressfisch. on 26 Sep 11, 20:33:30 and this is why we call it red letter media? I? can't believe ... By: NemanorTheAlmighty. on 22 Aug 11, 09:48:38 I? can't believe this only has 5k views lol Brilliant. Hard to ... By: TheGreatBug729. on 09 Jul 11, 05:37:23 Brilliant. Hard to believe this isn't? actually Plinkett. Plinkett Sr., that is. Though, the ... By: twooffour. on 28 Jun 11, 02:06:56 Though, the Airbender? parody comes pretty fucking damn close :D Your ending is genius. amazing? By: NemanorTheAlmighty. on 20 Jun 11, 06:13:09 amazing? nice accent good ... By: SRNF. on 20 May 11, 16:42:56 nice accent good job? simply? brilliant! By: rhBOSS. on 18 May 11, 21:47:23 simply? brilliant! lol!? By: carltonpowers. on 17 May 11, 18:18:50 lol!? Plinkett? already ... By: Galacticavatar. on 10 May 11, 10:11:54 Plinkett? already had a son. He hung himself in the bathroom of a gas station. The? Plinkett ... By: Brehserman. on 27 Apr 11, 16:48:15 The? Plinkett genome is spreading. Good... Good... Just curious, has? ... By: Sw3rt0. on 26 Apr 11, 13:20:02 Just curious, has? Mike ever responded to this? Sorry to disappoint ... By: mark84j. on 11 Apr 11, 16:13:17 Sorry to disappoint you, but nobody has the same touch as Mr. Stoklada. Only? Mr. Stoklada does. Eh. You don't have ... By: Bear2Roo. on 11 Apr 11, 15:43:03 Eh. You don't have quite the same touch? Mike Stoklasa does... One of which ... By: mark84j. on 31 Mar 11, 22:01:29 One of which smelled? of melted crayons. i wonder witch one ... By: gooddarkjedi. on 31 Mar 11, 21:14:05 i wonder witch one of his marrige are you product from?? Good...? good... By: illustriouschin. on 12 Mar 11, 07:01:59 Good...? good... the ending to? this ... By: spartacus36526. on 26 Feb 11, 04:31:51 the ending to? this is fucking great! i think i'm your ... By: SeekHunt1334. on 21 Feb 11, 12:42:13 i think i'm your son.... NOOOOOOOOOoooo- NOOooooooo? Time to muck this? ... By: Dalek1230. on 19 Feb 11, 03:29:07 Time to muck this? up with some prequels ... Just awesome!:D? By: Twomoredays. on 18 Feb 11, 08:41:41 Just awesome!:D? Nooo!!!! NOOO!!!!? By: Clonetrooper17. on 09 Feb 11, 03:37:33 Nooo!!!! NOOO!!!!? Plinkett's NEW Review is up nao! Posted by: RedLetterMedia Video duration: 104 seconds Global video hits: 86161 www.redlettermedia.c om - COP DOG!!! See Plinkett dismantle the worlds most favoritests movie about a ghost cop dog Related: red, letter, media, plinkett, cop, dog, star, wars, reviews, harry, s. Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: Goddamn don't? fuck ... By: MrFukov85. on 18 Apr 12, 16:21:50 Goddamn don't? fuck with me like this. I was actually excited for a while there. :( Get this old shit ... By: thenewaeon. on 12 Apr 12, 05:21:02 Get this old shit out of my new shit! Fucking shiftless programmer? fucks! FUCK YOU FUCK? YOU ... By: Deepdesert. on 12 Apr 12, 01:16:02 FUCK YOU FUCK? YOU FUCK YOU FUCK YOU FUCK YOU I thought ... By: samwyse2006. on 12 Apr 12, 00:34:57 I thought Netherworld of the Force was something random Plinkett made up, but then? I googled and it's not. Um.... why is this ... By: negima1276. on 11 Apr 12, 16:55:16 Um.... why is this in my sub box?? why is? this in my ... By: Mr44centz. on 11 Apr 12, 05:46:19 why is? this in my sub box... this is a year old Well at least? I ... By: kev0ut. on 11 Apr 12, 05:39:51 Well at least? I don't have to stay up until 3am RLM filled my sub ... By: samipod42. on 11 Apr 12, 01:19:03 RLM filled my sub box and I was so excited when I saw a? new review. Now I am disappointed... :( Why is a year old ... By: WheresMahBacon. on 11 Apr 12, 01:14:18 Why is a year old video showing? up in my box now? What the hell is up ... By: Redyumyum67. on 10 Apr 12, 22:53:00 What the hell is up with my subscription box today? Seems like? other people are having the same problem. Shame. Really got excited for a second. RLM flooded? my ... By: StarcrossedPacific. on 10 Apr 12, 21:23:53 RLM flooded? my subscription box WHY IS IT IN MY? ... By: WeEatBrainz. on 10 Apr 12, 20:28:30 WHY IS IT IN MY? YOUTUBE SUBSCRIPTION BOX WTFFFF!!! I was super exited ... By: fdizzle2569. on 10 Apr 12, 19:01:56 I was super exited for? about 7 seconds.... what the? fuck is ... By: mGoLos. on 10 Apr 12, 18:52:56 what the? fuck is this shit?! My youtube box is a time machine? Holy uploads? ... By: GuyJolly. on 10 Apr 12, 17:47:33 Holy uploads? plinkett! Where the HELL is? ... By: xCrazyxJayx. on 10 Apr 12, 16:16:22 Where the HELL is? his review of The Last Airbender? look at? the date ... By: itzxx420l33tHALOxxzz. on 10 Apr 12, 15:51:49 look at? the date this was uploaded, I think sub boxes fucked up Oh, I travelled ... By: tml4873. on 10 Apr 12, 14:47:15 Oh, I travelled into the past instead. Oh? well, I watched it again, and it was worth it. How come I remember ... By: tml4873. on 10 Apr 12, 14:20:07 How come I remember seeing this "new" review? months ago? Did I travel into the future back then? Lolled at the ... By: BurntOrangeMan. on 10 Apr 12, 13:57:09 Lolled at the Sparkey trailer. He should? review Quigley though Cop dog. A film ... By: venger. on 10 Apr 12, 13:15:28 Cop dog. A film that doesn't feature a cop nor? a dog. Thanks for filling? ... By: jarrenskater. on 10 Apr 12, 09:16:53 Thanks for filling? up my sub box assholes The cat? ..... OMFG ... By: TheKingFucktard. on 10 Apr 12, 06:01:16 The cat? ..... OMFG !!! Sub box: Its? ... By: LevanEvan. on 10 Apr 12, 05:45:13 Sub box: Its? redlettermedia all the way down. XD Lol? wtf fuk u inbox By: SuperOatmealbear. on 10 Apr 12, 03:59:55 Lol? wtf fuk u inbox Merry Christmas, Mr. Plinkett Posted by: Cartoonamations Video duration: 197 seconds Global video hits: 9961 Mr. Plinkett: animated series #3 On behalf of all of your fans- may all your Christmases be white, Mr. Plinkett and Redlettermedia. Star Wars Review. george lucus. Mike Stoklasa. Half in the Bag. 789films789. Adventures of the Blue Car. Cartoonamations. Jordie Clock. Related: mr. plinkett, cartoon, animated, review, redlettermedia, 789films, cartoonamations, mike stoklasa, half in the bag, new review Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: ya? By: ndgh209. on 23 Mar 12, 16:16:30 ya? roses are red ... By: abdalaez. on 09 Mar 12, 20:30:53 roses are red violets are blue i really love Mr. Plinkett review !? I love Half in the ... By: Saxifrage040210. on 05 Feb 12, 09:08:16 I love Half in the Bag. I? mean, I hate it, you assholes. Why do people hate ... By: Greggboosh. on 02 Feb 12, 07:12:20 Why do people hate Half in the Bag so much? I enjoy it, obviously he can't do Plinkett reviews? for every movie. Half and the Bag is a good substitute that takes care of all the crap movies that are gushing out of the theaters. Easily one of my ... By: bibihelai. on 25 Jan 12, 23:26:57 Easily one of my favourite YouTube videos. You have? an amazing (and rare) sense of humour that I'm afraid lots of people can't appreciate. I love? Rick in ... By: MikeRyu. on 20 Jan 12, 02:29:49 I love? Rick in this video. "I wasn't there." ... By: ElveeKaye. on 18 Jan 12, 22:51:47 "I wasn't there." OR WAS HE?? *dun dun DUNNNNN*? you keep them ... By: supersoundninja. on 15 Jan 12, 04:37:54 you keep them coming mr plinkett... keep the reviews...? cumming... Dude ... By: luigi32791. on 14 Jan 12, 20:07:54 Dude redlettermedia? liked your video, get ready for an explosion of new views. I like the Star? ... By: HawaiiKnut. on 14 Jan 12, 15:06:41 I like the Star? Wars Chrismas Special reference. WHERE THE FUCK IS ... By: theshak06. on 14 Jan 12, 02:04:11 WHERE THE FUCK IS TWILIGHT FUCKING REVIEW CUNT? FACE!!!!! Censoring ''bastard ... By: BWGgy. on 13 Jan 12, 23:48:07 Censoring ''bastard'' is sooo Ninedees! Or maybe he just said ''bass-terd'' ,that? could be less offensive, though more juvenile... Plinkett you are? a ... By: crinoid1919. on 13 Jan 12, 23:12:22 Plinkett you are? a genius!!! I? guess I'll quit ... By: CrunchBogus. on 13 Jan 12, 22:24:09 I? guess I'll quit being a fucking smartass about Evans being the original Plinkett and shit. Oh! Just loved the ... By: Monkofmagnesia. on 13 Jan 12, 20:36:08 Oh! Just loved the ending! I was laughing? so hard! Even the pizza roles were fake! Fuck is considered ... By: DoctorPorkenfries. on 13 Jan 12, 12:56:35 Fuck is considered to be a much, much worse word than? bastard. lol, Bea Arthur? By: xXBr4ndonDXx. on 13 Jan 12, 07:27:58 lol, Bea Arthur? Why is "Fat Fuck" ... By: TheCryoScales. on 13 Jan 12, 07:04:43 Why is "Fat Fuck" censored but? "Bastard" isn't? the drawing of Rick ... By: Mezmerio. on 11 Jan 12, 21:40:22 the drawing of Rick Ber--McCallum is amazing.? Oh my? God! Fake ... By: wiiagent. on 25 Dec 11, 14:53:06 Oh my? God! Fake Plinkett! I want? some Fake ... By: Lurdiak. on 21 Dec 11, 12:23:10 I want? some Fake Pizza Rolls Actually Rick ... By: theblocksays. on 20 Dec 11, 23:53:37 Actually Rick McCallum appears to have had? a stroke there, internally he blames this on Lucas LOL! Just do a bit of ... By: shadowhexogram. on 17 Dec 11, 07:38:35 Just do a bit of searching in the redlettermedia channel. In fact one of? the related videos is right here i'm looking at it while I type this down. can anyone link me ... By: ashburn247. on 16 Dec 11, 06:06:41 can anyone link me to? the video where he reads these? thanks I love you.? By: Mbop28. on 13 Dec 11, 21:18:37 I love you.? Harry S Plinkett Amigurumi doll Posted by: pigeonweed Video duration: 12 seconds Global video hits: 4588 Harry S Plinkett is a character by Mike Stoklasa from Red Letter Media (www.redlettermedia. com) He comes with accessories. More details here periwinkleimp.devian tart.com Related: harry, plinkett, nadine, star, wars, prequel, review, mike, stoklasa, red, letter, media, ooak, amigurumi, crochet, doll, playset, action, figure, toy Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: If I had t his ... By: topperheartramada. on 21 Nov 11, 17:18:34 If I had t his thing I'd keep it? on my desk and keep pressing that button a million times a day. Eventually I'd be committed and have to take medicine of my own. Amigurumi, those ... By: Ryuuken24. on 25 Jun 11, 00:18:13 Amigurumi, those dolls looks like satanic ritual dolls, and believe you me when I say this, I know a lot about satanic dolls. That game little big planet, it seems they somehow got the idea of taking satanic dolls as characters, it still weird's? me out. It was a present.? ... By: pigeonweed. on 23 Jun 11, 01:54:03 It was a present.? It's not for sale. Welcome to the ... By: pigeonweed. on 23 Jun 11, 01:53:38 Welcome to the world of Amigurumi. =)? where? can I get ... By: U2met86. on 23 Jun 11, 00:10:00 where? can I get one? Little Big Planet? ... By: commandereddy. on 22 Jun 11, 22:34:29 Little Big Planet? dolls!! Cool!! You you see if you can get them as playable characters. ugh....uhnnn.. ... By: ChildrenofAmory. on 22 Jun 11, 22:06:13 ugh....uhnnn..MERKINS....Fuck the pain away....fuck the pain away. This is awesome, well done on the? dolls. I'd love a Plinkett plushie. awesome ? By: veggiemuncher86. on 22 Jun 11, 20:12:37 awesome ? That is? brilliant. By: apcreed. on 22 Jun 11, 20:11:17 That is? brilliant. Dude, I sooo have ... By: pigeonweed. on 22 Jun 11, 19:01:29 Dude, I sooo have to make that? next! Hey, where's the ... By: MetalSlugzMaster. on 22 Jun 11, 18:58:57 Hey, where's the Darth Maul doll that says, "Ah'm a? fuckin' badass" JUST TAKE MY? MONEY By: retretlol. on 22 Jun 11, 18:33:46 JUST TAKE MY? MONEY Nice!? By: TommieV. on 22 Jun 11, 18:18:52 Nice!? There is a cat and? ... By: pigeonweed. on 22 Jun 11, 17:54:26 There is a cat and? pizza rolls and ego award. I made this as a ... By: pigeonweed. on 22 Jun 11, 17:52:29 I made this as a present for? him. Only? if he sells ... By: HomeBurger. on 22 Jun 11, 16:54:44 Only? if he sells it. I want to? buy a ... By: freddiekarlbom. on 22 Jun 11, 16:14:17 I want to? buy a Plinkett doll You're a fucking ... By: MidnightGrunt. on 22 Jun 11, 16:04:23 You're a fucking dumbass kid.? You can't get a lawsuit for this shit. HAH !? By: bbhaver. on 22 Jun 11, 15:55:40 HAH !? I NEED THAT DOLL ... By: dekio. on 22 Jun 11, 15:54:26 I NEED THAT DOLL O_O? Mr. Plinkett is ... By: LionsEdge. on 22 Jun 11, 15:51:07 Mr. Plinkett is always funnier than I remember him to be? haha. Thanks to this guy ... By: TheInstantClassic1. on 22 Jun 11, 15:44:03 Thanks to this guy I can never look at? pizza rolls the same way anymore. I want one of both ... By: Jkfilms7. on 22 Jun 11, 14:47:34 I want one of both Plinkett and Nadine, I'm prepared to offer? you a large sum of money. then eat ? By: darkoni12398. on 22 Jun 11, 12:38:27 then eat ? All? of my money! By: olliegibbons. on 22 Jun 11, 11:43:59 All? of my money! STOP PLINKETT 2012 Posted by: Cartoonamations Video duration: 337 seconds Global video hits: 7895 a fan-made tribute to Harry S. Plinkett. Mike Stoklasa and RedLetterMedia have been good sports for tolerating these rip-offs... err.. homages. Mr. Plinkett Animated Series #4. Titanic. 100 years. Sinking. Star Wars. Star Trek Next Gen. TNG. Kony 2012. Gamestation 2.0. Cartoonamations. 789films789. Shaun McKinnon. Related: mr. plinkett, cartoonamations, animated series, titanic, kony, redlettermedia, half in the bag, mike stoklasa, tng, gamestation 2.0, star wars review, animation, space cop Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: Space Cop. DID I ... By: Homestar20845. on 04 May 12, 06:00:43 Space Cop. DID I GIVE YOU PERMISSION TO? TALK I love the bottle ... By: Mezmerio. on 02 May 12, 22:12:56 I love the bottle of coke? and pepto bismol. I can't get enough ... By: topperheartramada. on 28 Apr 12, 13:39:15 I can't get enough of your cartoons. All the best from a fellow Plinkett fan.? In fact there? was. ... By: marcus8374. on 25 Apr 12, 10:33:42 In fact there? was. His name: space cop. the? fuck did I ... By: TheDetective420. on 23 Apr 12, 15:39:44 the? fuck did I just watch sup dog we heard ... By: thespread. on 19 Apr 12, 09:05:28 sup dog we heard you liked digital mashup culture. So we mashed up a mashup? so you can watch a mashup that's been mashed up A Dewey '48 bumper ... By: BWGgy. on 19 Apr 12, 03:39:49 A Dewey '48 bumper on at least a? 76 Accord, am I going crazy? was a time traveler involved? I? love how ... By: ChildrenofAmory. on 19 Apr 12, 03:38:19 I? love how Plinkett still has Data's Sherlock Holmes costume on. It did? at 3:37 By: ChildrenofAmory. on 19 Apr 12, 03:36:38 It did? at 3:37 Another? great ... By: ChildrenofAmory. on 19 Apr 12, 03:31:33 Another? great video, well done! Where's half? in ... By: xychr0. on 17 Apr 12, 20:18:01 Where's half? in the bag? Awesome? job By: yumyuk. on 17 Apr 12, 18:29:20 Awesome? job Um...what did i? ... By: toran1995. on 17 Apr 12, 12:03:53 Um...what did i? just watch? Im confused.... F- Bot 5000? should ... By: sth128. on 17 Apr 12, 05:07:06 F- Bot 5000? should make an appearance. What the hell did I ... By: calistman222. on 17 Apr 12, 03:59:16 What the hell did I just watch?? stop it? By: tIs4gatorbait. on 17 Apr 12, 00:43:57 stop it? Yes but also 'Call ... By: Cartoonamations. on 17 Apr 12, 00:31:29 Yes but also 'Call To? The Cows' from William Tell Overture. @TheInflicted - Penny's Theme actually. Thanks Everybody!! And I ? 1/2 in the Bag too. 4:39 Day of the ... By: pandemiCDG. on 16 Apr 12, 19:43:19 4:39 Day of the Tentacle music in the? background? what the? hell is ... By: PsySupplies. on 16 Apr 12, 17:50:46 what the? hell is going on lol they got bored ... By: Hesdedjim1701. on 16 Apr 12, 17:35:36 lol they got bored and used the car/side scrolling part? to kill time. lol ;) "What a horrible ... By: Artman1991. on 16 Apr 12, 16:05:09 "What a horrible idea it was? to do that..." Definitely not this video. It was good! :) Wait! What?? Marty ... By: HarryPlinkett. on 16 Apr 12, 13:41:03 Wait! What?? Marty never flew the? DeLorean, is this some kind of trick? yay special tupac, ... By: sumbuddyx. on 16 Apr 12, 09:50:08 yay special tupac, fucking rad!? Who the hell ... By: wiiagent. on 16 Apr 12, 09:29:54 Who the hell doesn't? Also, just to 1? up you: I LOVE HALF IN THE BAG! Such a great ... By: ThaPoofinator. on 16 Apr 12, 08:59:19 Such a great mishmash of? soundclips and animation. Plinkett's Next Review Posted by: RedLetterMedia Video duration: 70 seconds Global video hits: 158404 What is Plinkett up to? Even he doesn't know... www.redlettermedia.c om Related: mr., plinkett, star, trek, wars, red, letter, media Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: I think it's Mike ... By: dylanwoodson7. on 26 Mar 12, 17:10:50 I think it's Mike Stoklasa,? same as Mr. Plinkett. Whoever does the ... By: RichardM137. on 14 Mar 12, 15:30:58 Whoever does the voice for the emperor in these videos, it sounds REALLY close? to the original. "The one that's out ... By: ProSitu. on 03 Mar 12, 20:01:20 "The one that's out now,? or...?" why? review cop dog ... By: tacticus0010. on 21 Feb 12, 07:41:34 why? review cop dog.. and baby's day out.. wtf plinkett do TWILIGHT YOU PIZZAROLL EATING PSYCHO do a? twilight ... By: HootsMcGruff. on 28 Dec 11, 03:45:50 do a? twilight review please I love how he ... By: SuspenseSmith. on 09 Dec 11, 03:10:29 I love how he actually made a review? for cop dog. @RedLetterMedia ... By: Horoquin. on 12 Nov 11, 09:16:16 @RedLetterMedia Stop following the George Lucas path, and continuing your disregard and contempt for your audience.? I speak for most, when I say: Get back to Plinkett reviews, and shut down this bullshit, annoying "Half In the Bag" shit. We understand that you wish to give your 'friends' some screen time. Well, you're giving them way too much screen time. They are not funny or entertaining. They are fucking dead weight and unnecessary distractions. BRING THE REAL PLINKETT BACK! That's not fair you ... By: KhasarDeTemplari. on 13 Oct 11, 23:45:05 That's not fair you sensin' me. ? When plinkett says? ... By: moviebakerperson. on 04 Oct 11, 00:56:23 When plinkett says? coming soon he means it That's not fear? ... By: reborntheglassbatch. on 25 Aug 11, 23:02:56 That's not fear? you sense in me, that's taco salad. it's on his? website By: randomperson1701. on 17 Aug 11, 19:29:00 it's on his? website So, they DID do ... By: MaurusRehmahrntahn. on 13 Aug 11, 21:34:37 So, they DID do Star Trek and they DID do? Cop Dog. Huh. Maybe if they're working in reverse order that means they'll do Twilight? :P But? I want a ... By: WhitetheDark. on 04 Aug 11, 13:49:03 But? I want a Twilight review!!! DEW IT? !!! By: northstarprod. on 26 Jul 11, 11:10:31 DEW IT? !!! Yeah, it? would ... By: TheSevenCamels. on 20 Jul 11, 13:37:25 Yeah, it? would completely fit his style too, which is showing how popular stuff that stupid fans enjoy can be Sh*tty too. HOLY SHIT! I just ... By: spartacus36526. on 09 Jul 11, 03:25:32 HOLY SHIT! I just found? it! He's reviewed Cop Dog!!! Still waiting on ... By: spartacus36526. on 09 Jul 11, 03:20:07 Still waiting on the? Cop Dog review .... cop dog?? By: GarlandFraser. on 06 Jul 11, 05:19:15 cop dog?? coming soon? = 11 ... By: TheInspector3000. on 29 Jun 11, 05:01:56 coming soon? = 11 months very clever plinkett..... "The kids decide to ... By: Crymson1. on 27 Jun 11, 07:32:09 "The kids decide to investigate the dad's murder, because apparently the police? have forgotten about it. Police departments generally give low priority to unsolved cop murders." COP DOG!!! ? By: Crymson1. on 27 Jun 11, 07:30:24 COP DOG!!! ? And here I? thought ... By: ltflak. on 26 Jun 11, 12:37:03 And here I? thought he was joking... I guess it? really ... By: smsteve888. on 26 Jun 11, 08:17:39 I guess it? really was unavoidable/his destiny. Your? face when he ... By: DescentIntoMadness11. on 25 Jun 11, 20:47:53 Your? face when he finally did Cop Dog. I guess Plinkett ... By: Wizardington. on 25 Jun 11, 06:16:49 I guess Plinkett wasn't lying about Cop Dog.? :D Mr. Plinkett is going to microwave his cat! Posted by: CharlesP2009 Video duration: 25 seconds Global video hits: 14450 Most of my buddies missed this clip from the very end of Red Letter Media's Star Wars Episode III Review Epilogue, Revenge of Nadine, so I decided to upload it here. Mr. Plinkett is about to microwave something he shouldn't! Related: red, letter, media, mr., harry, s., plinkett, star, wars, episode, iii, revenge, of, the, sith, review, microwave, microwaveable, cat, kitty, felis, catus, not, meat, cathicken, pizza, rolls, worst, movie, ever, craigslist, trek, nadine, charlie, and, chocolate, factory, come, with, me, youll, be, in, world, pure, imagination, take, look, see, into, your, well, begin, spin, traveling, my, creation, what, will, defy, explanation Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: You gotta make sure ... By: Dukeobelding. on 23 Apr 12, 21:50:14 You gotta make sure it's alive because then it's the freshest meat!!!? :D I Typed This In Coz ... By: J4zzi2000. on 19 Apr 12, 14:58:27 I Typed This In Coz In Class Today We Saw A Pic? Of This Happening But It Really Did Go In The Microwave!! I actually knew an ... By: Canadish. on 22 Mar 12, 04:54:17 I actually knew an old guy who did this to his cat once. The poor thing lived but was...disturbed for the rest? of it's days. It was my girlfriend that adopted it afterwards... i want a? pizza ... By: jjeremmy. on 03 Mar 12, 21:52:10 i want a? pizza roll! the funniest thing ... By: topperheartramada. on 27 Feb 12, 16:13:07 the funniest thing is that if you take alook at that cat you can immediately tell it's? actually one happy, spoiled kitty that gets lots of treats. LOL, the captions ... By: CharlesP2009. on 27 Feb 12, 14:47:38 LOL, the captions aren't even close!? Bahahahahahahaha!? ... By: ZoMgNoObHaTeR. on 27 Feb 12, 04:39:07 Bahahahahahahaha!? subbed! This is HILARIOUS! well, he did kill ... By: gethsoftware. on 08 Feb 12, 20:45:58 well, he did kill his first cat/possible first wife? but she did come back when the time line changed, now she is trying to kill him? Don't look at me ... By: WardogCinema. on 31 Jan 12, 17:06:51 Don't look at me like that. Plinkett reviews videos all the time and points out mistakes. Just goes to show you that even the scariest cat milking psychopath can make mistakes. Also? the misplaced hands thing would explain why Plinkett can't hang up a phone properly. Not sure if anyone ... By: WardogCinema. on 31 Jan 12, 17:05:37 Not sure if anyone else ever noticed this, but you see that shadow at the back of the microwave that looks like the silhouette of someone staring at the microwave? Look to the top left corner of the video and you'll see the actor's head shadow appear. Also, if you pay close attention to the shadow inside the microwave, it looks like Plinkett is using his left hand instead of his right... so either he has his right hand? attached to his left hand or this is a filming mistake. waahahahaha? By: ninjatrixx. on 12 Jan 12, 23:33:21 waahahahaha? "I WILL? MAKE IT ... By: RickLowerboy84. on 09 Dec 11, 06:50:13 "I WILL? MAKE IT LEGAL!" - Man in a Black Cloak Who Is Not a Trademarked Character of Lucasfilm Limited It's so? funny, ... By: topperheartramada. on 01 Dec 11, 09:54:05 It's so? funny, because that cat seems to be very happy. I always sing this ... By: topperheartramada. on 27 Nov 11, 15:07:47 I always sing this when? I microwave something. I love the idea ... By: topperheartramada. on 23 Nov 11, 17:23:16 I love the idea that Mike is the voice of Plinkett in the reviews, but not in the actual films with the? character of Plinkett. I remember he? sang ... By: Wingzero5555. on 18 Nov 11, 03:13:01 I remember he? sang this in a cartoon red letter media but I can't remember which video. I think it was in a cartoon of startrek 2 lb's of cooked c( ... By: IDF1987. on 18 Oct 11, 00:10:48 2 lb's of cooked c(at)hicken meat on craigs? list now Must be a clip from ... By: TheInstantClassic1. on 02 Oct 11, 16:00:35 Must be a clip from his cooking video, Eating Pussy? Why is every ... By: Cazz814. on 01 Oct 11, 06:02:22 Why is every sadistic? thing he does with his cat so frigging hilarious! ROFL---I remember ... By: sbcmarine81. on 29 Sep 11, 03:07:52 ROFL---I remember seeing? this when he first put it up, I never laughed so hard X'D. Video evidence ... By: CharlesP2009. on 24 Sep 11, 02:00:52 Video evidence suggests that he already completed? this heinous act and tried to sell the remains on Craigslist. Poor thing, it was such a cute obese cat. Why would mister ... By: Ropponmatsu2. on 23 Sep 11, 20:03:58 Why would mister Plinkett want to? microwave his cat? He loves his cat. The fact that it's alive means it's warm enough to fuck without any extra effort. rule 43 for both ... By: anime1973. on 16 Sep 11, 04:16:50 rule 43 for both the cat and the song.? Plinkett Vinesauce Promo Posted by: vinesauce Video duration: 39 seconds Global video hits: 1277 A promo from the one and only Harry S. Plinkett himself! Audio recorded by Plinkett, video created by me. Related: plinkett, harry, redlettermedia, vineswim, vinesauce, pizza roll, star wars, review, stream Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: I'll? skype you a ... By: Iriscal. on 22 Jun 11, 22:05:03 I'll? skype you a pizza roll. Anybody wanna pizza ... By: clstirens. on 01 Apr 11, 20:42:29 Anybody wanna pizza roll?? dat "but i will"? ... By: pota769. on 19 Feb 11, 23:03:35 dat "but i will"? gets me every time This? is the best By: Sraoshii. on 19 Feb 11, 18:26:08 This? is the best :D? By: tr1234. on 19 Feb 11, 18:01:46 :D? That was the best ... By: ArronWeeks. on 19 Feb 11, 14:29:27 That was the best thing? I've heard all year Death? to Vinny By: PodpolkovnikBlaise. on 19 Feb 11, 14:29:22 Death? to Vinny Did I just watch an ... By: 395Javelin. on 19 Feb 11, 09:06:21 Did I just watch an advert?? He's right,? though ... By: Ruisutsrugi. on 19 Feb 11, 07:42:21 He's right,? though. Fuck that Vinny guy. Plinkett's New Review Posted by: MrPlinkett Video duration: 48 seconds Global video hits: 21069 I finished my next review. Enjoy! Related: mr., plinkett, babys, day, out, comedy, review, star, trek, wars Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: thumbs up if you're ... By: ArcanePath360. on 03 Dec 11, 12:36:50 thumbs up if you're back here? for the umteenth time just to hear him say his cat fell down the stairs :D GET OUTTA MY? ... By: RupturedFarms. on 14 Aug 11, 18:35:51 GET OUTTA MY? POPCORN TUB. I think that one ... By: kilamonjaru. on 22 Sep 10, 13:16:43 I think that one was taken? down pretty immediately for copyright. Is this gonna be ... By: ERoBB1. on 03 Sep 10, 17:15:59 Is this gonna be put on Youtube?? I can't ever get through the review on the RedLetter player. Two things: Your ... By: Veredika. on 02 Sep 10, 04:26:09 Two things: Your reviews are more entertaining than the actual movies. And You should direct films. I? haven't seen fast paced editing and interweaving of elements like this since Arrested Development. You are the best. Well thanks!! I ... By: reviewreviewer1. on 28 Jul 10, 19:48:24 Well thanks!! I also send you an invention to add you as afriend. I will first release a trailer for all my reviews in which I explain my rating-system and some other stuff that is important to know if you want? to see my reviews and than I will first do Bak to the future trilogy, than terminator franchise, and than all six Star Wars movies!! i will watch your? ... By: smiffy992. on 28 Jul 10, 18:51:49 i will watch your? videos when you release them :) Yeah because ... By: reviewreviewer1. on 28 Jul 10, 18:22:15 Yeah because discussing 90 minutes of criticizm on the prequels is impossible with only 500 letters and I also gave a lot of arguments why the prequels would be good and my spamming is only the opposite of? everybody sayingGeorge should die and hateS sTAR wARS BLAH BLAH BLAH OVER AND OVER AGAIN, and it`s true I haven`t made my reviews yet but I ask people to see it when it comes out because as I said it`s impossible to tell all my arguments in these comments!!!! you keep promoting ... By: smiffy992. on 28 Jul 10, 17:33:02 you keep promoting your own videos (that you haven't made yet) and i think he is a little annoyed with you spamming? the comments with "the prequels are awesome" on every star wars vid HEY WHAT`S UP ... By: reviewreviewer1. on 28 Jul 10, 00:34:10 HEY WHAT`S UP REDLETTERMEDIA, WHY DID YOOU? BLOCK ME FROM THE COMMENT PAGE/ I DIDN`T DO ANYTHING WRONG!!!!!!!!!!!!!!!!!! you can run it? ... By: LordThree. on 18 Jul 10, 19:51:52 you can run it? entirely in html 5 if you want Newer versions of ... By: joeottoson. on 16 Jul 10, 03:34:21 Newer versions of Flash? use h.264 for the encoder. lmao thats still ... By: yankeepunk3000. on 15 Jul 10, 09:57:34 lmao thats still random? how? was that a patern lol I love all your ... By: MrsAbaraiRenji. on 15 Jul 10, 00:35:27 I love all your reviews! This one? was great - really random in terms of choice but very good! Keep up the awesome the review? was ... By: SkepticalMuffin. on 10 Jul 10, 15:22:39 the review? was fucking awesome, keep it up mr. plinkett he is going to do ... By: SquareKiteGaming. on 10 Jul 10, 09:14:08 he is going to do episode 3. have you noticed a pattern: phantom menace, avatar, episode 2, babys day? out... i wished you did ... By: jakatak1134. on 01 Jul 10, 17:54:00 i wished you did starwars 3 or lord? of the rings. babys day out was kinda random and didnt have as much potential. thumbs up if you agree. good review tho youtube is flash ... By: zalmatra. on 28 Jun 10, 16:11:57 youtube is flash unless something? changed? Lol I just googled ... By: MetulManiac. on 27 Jun 10, 16:53:32 Lol I just googled merkins... goondess gracious that is disgusting.? @MetulManiac: I ... By: Boonehams. on 27 Jun 10, 03:47:33 @MetulManiac: I thought you would've had more of a problem with the 16 -- no wait, it was 32 --? salt and pepper-colored merkins. If you? want people ... By: TOstevo. on 26 Jun 10, 22:24:37 If you? want people to visit your site put a link in the description. Put on YouTube ... By: Fritz0id. on 26 Jun 10, 08:59:11 Put on YouTube please. Your website uses? flash. I liked? your new ... By: Geekboy20X6. on 26 Jun 10, 03:30:11 I liked? your new review... does that mean I won't disappear? I loved how? there ... By: AedarkZZ. on 25 Jun 10, 16:08:23 I loved how? there was a pizza rolls advert before the review FUCK THE? PAIN AWAY By: standinstann. on 25 Jun 10, 07:03:46 FUCK THE? PAIN AWAY Plinkett Star Trek Review Compiliation Posted by: theunicorner Video duration: 664 seconds Global video hits: 985 my fave quotes from harry plinkett's star trek reviews you can find them at redlettermedia.com Related: star trek, review, plinkett, lulz Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: It takes a talented ... By: MrBuch169169. on 06 Apr 12, 11:14:15 It takes a talented comedian to make you laugh just by singing 'Let's All Go to? the Lobby' in a funny voice. :) PLINKETT likes Mannnnnnnngah Posted by: Huntie Video duration: 295 seconds Global video hits: 2275 A tribute to the best modern concept of the "movie review". Harry S Plinkett knows his cinema, makes you laugh, and even teaches you a thing or two. It's only his opinion though...but if you don't agree with it you're wrong. Watch his reviews on his webzone: www.youtube.com Related: red, letter, media, tribute, mr, plinkett, robo, cop Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: "Evagalion!!!"? By: MarcusOnielHaynes. on 25 Apr 12, 14:32:02 "Evagalion!!!"? Whats this song ... By: peacocksandwhich. on 16 Jan 12, 14:20:23 Whats this song called?? 8 people disliked? ... By: Galentw. on 16 Jan 12, 08:33:58 8 people disliked? this video, but NOOOT ME! This was awesome! ... By: GoldenGyroBalls. on 01 Dec 11, 10:59:38 This was awesome! For some reason, I would like to see what would happen if? Mr. Plinkett watched Eva. Shit would ensue. TOOOO? FUNNY!!! By: crinoid1919. on 12 Oct 11, 04:22:18 TOOOO? FUNNY!!! Dude that was ... By: sam6350. on 02 Oct 11, 06:27:55 Dude that was awesome. "You wanted a? free ice cream didn't ya?!" ... that part had me dying man. You should send this to redlettermedia, I'm sure they'd love it. 0:45 I have that ... By: Sabohaque. on 12 Aug 11, 00:58:05 0:45 I have that picture of krmrr on a t-shirt. check it out on muh webzone? PS3!!!!!!!!!!!!!? By: DutchTimepq. on 13 Jul 11, 17:22:24 PS3!!!!!!!!!!!!!? This is? so full of ... By: twooffour. on 13 Jul 11, 08:42:10 This is? so full of win :D GODDAMNIT i love? ... By: bewarethepatientman. on 11 Jul 11, 21:37:22 GODDAMNIT i love? when he mumbles hahhahaha Ha Ha great ... By: Epiphany347. on 26 Jun 11, 12:32:25 Ha Ha great impression of plinkett. Love? how you stuck Evangelion in there. In the Killing/Art ... By: KyojinKaiju. on 21 Jun 11, 04:03:27 In the Killing/Art room... Do I see what I? really see? Something that looks like Godzilla getting his... You know... Blasted off. I know I'm getting ... By: KyojinKaiju. on 08 May 11, 01:30:06 I know I'm getting pizza rolls. ;)? thumbs up for? ... By: GodzillaBoy3. on 02 Apr 11, 06:57:35 thumbs up for? EVANGELON! Woo-Hoo! 2 people aint ... By: Huntie. on 02 Apr 11, 04:45:00 2 people aint gettin? pizza rolls. Palpatine: The view ... By: Huntie. on 25 Feb 11, 21:16:59 Palpatine: The view count? is 66! you iz very skary.. ... By: GoweskyCamaronV. on 22 Feb 11, 15:50:07 you iz very skary...... my chihuahua hides under the blankets...? LMAO wow that was ... By: thejoker9998. on 22 Feb 11, 11:51:51 LMAO wow that was perfect plinkett there huntie very nice! i friggin? love that guys reveiws. your art and every ... By: windknight360. on 22 Feb 11, 07:06:13 your art and every thing else are awesome? Plinkett Sings Let's All Go to the Lobby Posted by: Dominic555555 Video duration: 39 seconds Global video hits: 19314 Download the mp3: www.mediafire.com Mr. Plinkett sings the classic song Let's All Go to the Lobby. Featured in Redlettermedia's latest review of Star Trek www.redlettermedia.c om Go watch it if you haven't already! Related: plinkett, sings, lets, go, to, the, lobby Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: where did you get? ... By: GermanStreetOrgan. on 30 Mar 12, 01:49:30 where did you get? this? Are there pizza ... By: RevengeOfTheKaizer. on 08 Mar 12, 06:50:22 Are there pizza rolls in? the lobby? Time? for some ... By: Cap285. on 26 Feb 12, 19:58:54 Time? for some Pizza Rolls. I can imagine him ... By: ultrabrilliant. on 04 Jan 12, 17:06:47 I can imagine him singing this while milking his cat.? Well, it delivers? ... By: BradTheProducer. on 03 Dec 11, 20:31:00 Well, it delivers? what it promises. 15000 of the views? ... By: topperheartramada. on 01 Dec 11, 10:04:17 15000 of the views? are by me. Sublime!? By: topperheartramada. on 24 Nov 11, 22:58:24 Sublime!? is that what you ... By: CrzyEX. on 13 Oct 11, 10:28:15 is that what you look like?? deffianatly the ... By: daralzand. on 04 Oct 11, 10:24:54 deffianatly the creepiest thing ive seen? or heard from mr plinkett ONE MORE TIME!? By: MrHEC381991. on 27 Sep 11, 03:02:59 ONE MORE TIME!? Not impossible to ... By: Maniac536. on 23 Sep 11, 01:01:21 Not impossible to convert the audio clip to? a ringtone, I think it's under time for most cell phone maximum ringtone lengths Um well duh popcorn ... By: TheInstantClassic1. on 19 Sep 11, 22:28:48 Um well duh popcorn can be beat; give me? a pizza roll any day He? must be ... By: MrBlockishMark. on 29 Aug 11, 23:26:29 He? must be revisiting he days when he was in his 50's can we? get pizza ... By: Knightmessenger. on 23 Jun 11, 21:50:27 can we? get pizza rolls in the lobby? thanks? By: GodzillaBoy3. on 08 Jun 11, 14:28:11 thanks? your comment maked ... By: kallemick. on 07 Jun 11, 17:53:03 your comment maked me laugh so much? that it hurts XD Watch plinkett.? ... By: AquariaSpirit. on 23 Apr 11, 23:57:35 Watch plinkett.? It's more educational than you think.... his asshole ... By: GodzillaBoy3. on 09 Apr 11, 01:30:27 his asshole probably? ate them! XD i think people ... By: kallemick. on 17 Mar 11, 11:14:27 i think people would laugh and then ask what the hell im using for a ringtone if i did...? if only i had a cable to my phone i would use it as a ringtone XD Wet's aw go to dah ... By: garamonde. on 11 Mar 11, 22:51:06 Wet's aw go to dah wobby and get us some pizza wolls. ? good? quesition i ... By: kallemick. on 10 Mar 11, 21:37:06 good? quesition i never noticed it XD Where's his? pants? By: arm8200. on 01 Mar 11, 10:22:25 Where's his? pants? this sounded so ... By: kallemick. on 01 Jan 11, 18:35:53 this sounded so funny that i almost cryed XD? This ain't going to ... By: illustriouschin. on 27 Dec 10, 10:21:47 This ain't going to become the next Rick Roll by itself, you gotta get? crackin! Plinkett's New Review is up now! Posted by: MrPlinkett Video duration: 106 seconds Global video hits: 22388 www.redlettermedia.c om it's up now my lovelies, although you may have seen it already by now eh? Anyone want a pizza roll, I have some in my pocket. They are all warm and squishy... Related: mr., plinkett, star, trek, 2009, review Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: Metal Gear Solid 3 ... By: AtsunobuSagara. on 02 Mar 12, 01:30:08 Metal Gear Solid 3 instead of 4. People is retarded; humanity will? die soon. That is? by far the ... By: Gazman2011. on 14 Dec 11, 06:43:19 That is? by far the best Emperor impersonation I've ever heard it shits on the voice actor who does the Clone war series. Bea? Arthur? By: topperheartramada. on 01 Dec 11, 10:05:36 Bea? Arthur? that sudden dive ... By: JabAtLife. on 27 Nov 11, 08:20:45 that sudden dive into video game reviews was hilarious. Crossfire was not as bad as people claimed? it to be. The hate was so much it turns out it wasn't even that bad MAKE MORE REVIEWS! ... By: ColossusShade. on 06 Nov 11, 03:33:05 MAKE MORE REVIEWS! ? "WHAAAAAAAT?!"? By: bebopbountyhead. on 01 Oct 11, 23:26:03 "WHAAAAAAAT?!"? Oh god, Palpatine's ... By: TheInstantClassic1. on 15 Sep 11, 01:15:07 Oh god, Palpatine's suggestions almost made me die of laughter. I think he missed an important game that also destroyed a treasured franchise with it's bullshit cliches, boring one? dimensional heroes, and killing off it's most popular character and villian; it's called Resident Evil 5!!! Wow, the Emperor ... By: Stuart154. on 14 Jun 11, 17:51:53 Wow, the Emperor has great taste.? Metal Gear Solid 3 ... By: ELMOisINNOCENT. on 04 Apr 11, 08:05:50 Metal Gear Solid 3 is the? shit ... By: BlackGnosis. on 04 Apr 11, 01:29:41 YEEEEEEEEEEEEEEEEEES? Its not gundam wing ... By: darkoni12398. on 24 Mar 11, 06:19:54 Its not gundam wing its Universal Century Kidou Senshi........oh god im? a nerd @donfolstar Hey,? ... By: terratrema. on 15 Mar 11, 06:39:10 @donfolstar Hey,? nobody asked you! Quiet your face-hole! Who could? possibly ... By: James27318. on 03 Mar 11, 20:17:39 Who could? possibly dislike this! 1. Art through ... By: donfolstar. on 11 Feb 11, 06:44:03 1. Art through Adversity. Adversity means he had to rely on input from others. CGI = no adversity. 2. You need to research how movies are made. Lucas only directed the IV, not V or VI. He was not the producer of any of them, nor was he the financier of the first movie. 3. So you are butt hurt about being blocked and your retaliation is typing garbled half thoughts on his? youtube videos- classy. When I actually saw ... By: shadowhexogram. on 04 Feb 11, 22:45:46 When I actually saw them. Well the first one I forgot I was young probably fell asleep. The second one I also barely remember when I first saw it. The third one though I remember and at the moment I thought it was pretty good. Obviously as years passed and reviews like these came along I started to think otherwise. When spike threw? that marathon I watched all of them. They are actually really boring when there isn't a fight going on. So? you dislike the ... By: reviewreviewer1. on 04 Feb 11, 19:14:13 So? you dislike the prequels??? Well I've seen a ... By: shadowhexogram. on 04 Feb 11, 19:12:15 Well I've seen a lot of people tackle these prequels before but I think he did it really well or at least was the most detailed and entertaining that I've seen. And maybe it's just me but after hearing all these people talk about whats wrong I kinda want to see someone actually say what could have been done right like someone tackle the task of making the prequels the movies? we would have liked without completely changing everything. Yeah that was my ... By: reviewreviewer1. on 04 Feb 11, 19:03:41 Yeah that was my problem with his point about what if Lucas had the same control back then, he did and? Episode IV is the result. Also what are your thoughts on the prequels and redlettermedia?????? Hmm. Then I have? ... By: shadowhexogram. on 04 Feb 11, 19:01:56 Hmm. Then I have? no idea then. Well the problem is ... By: reviewreviewer1. on 04 Feb 11, 18:52:15 Well the problem is Lucas had ownership over the films, and thereby could fire or just shut uop anuyone who worked for him. It`s true artists? are jmedled ith, but this is becfause they surrender ownership and c ontrol, whicjh is something Lucas didn`t. plus his number 1 conceern was control, meaning hee never made compromises. there are big reports of this in documentaries he actualy fired the editor, and basixly won a fight and fotrced the cinematogropher, to do what hwe wanted. Well back then he ... By: shadowhexogram. on 04 Feb 11, 18:18:20 Well back then he was a young? film maker and didn't have a lot under his belt so he really didn't have the power to fire people like he could now. As an artist I hear all the time about people who sent there stuff to hollywood and had it turned inside out by them. I'm not quite sure how that happens but it happens alot and one would assume the young george lucas could have been a victim to it as well. 1. Well less? ... By: reviewreviewer1. on 04 Feb 11, 09:36:33 1. Well less? control in terms of effects and fiolmaking techniques, not over the crew, 2. it doesn`t matter wheter the crew believe him, he wss there boss he could fire them, and shuit them up, so alrtough they vould refuse tio wor, they could not fdemand input, 3. I just ate a pizza, and since redlettermedia a blocked me with his other account, I stopped being a fan. The answer to your ... By: donfolstar. on 04 Feb 11, 09:31:02 The answer to your question is threefold. 1. Lucas had to film IV (mostly) in the real world, not a green screen studio. Location filming = less control than CGI 'magic'. 2. In 1977 nobody gave a fuck who George Lucas was compared to 1999. His added clout meant less input from other sources both formally and informally. 3. Do not question Mr.? Plinkett unless you don't want he should send you a pizza roll. Well if back then ... By: reviewreviewer1. on 04 Feb 11, 09:27:31 Well if back then he didn`t want meddling weither, why sdidn`t he jist fire them aswell??/ he owned the films, they were his projects.? he was the boss. Soo why would he allow that, he could just fire em. I believe back then ... By: shadowhexogram. on 04 Feb 11, 02:01:46 I believe back then even though he wanted to do everything without meddling from outsiders outsiders got there say in and effected his work. Nowadays with those? three movies in particular he called all the shots and everybody did what he told them too do or they were fired for meddling. Mr. Plinkett Updates and More! Posted by: RedLetterMedia Video duration: 173 seconds Global video hits: 88732 www.youtube.com Related: mr., plinkett, red, letter, media, reviews, comedy Display Video Comments | Hide Video Comments | Add Comment Latest comments made on this video: finally......can't? ... By: granceroblast. on 16 May 12, 06:13:18 finally......can't? wait any longer... How did this ... By: ShadowACS. on 16 May 12, 01:34:06 How did this comment come out a year ago when the video only came out a month ago?? o_0 Yeah, weird shit.? By: Quizerno. on 07 May 12, 03:44:22 Yeah, weird shit.? How the? hell are ... By: Deathshuck. on 06 May 12, 18:07:58 How the? hell are the top comments 1 year old if this video was published in April 9th 2012? REVIEW TWILIGTH? !! ... By: ImmaEverything. on 02 May 12, 23:22:35 REVIEW TWILIGTH? !!!!!!!!!!!!!!!!!! THAT SDS MOVIE GAVE FUCIN POLYIO HEY IF YOU WANT PIZZA ROLL ITS IN THE BASEMENT IN CORNER get off your fat ... By: DannyRodriguezFilms. on 28 Apr 12, 02:04:58 get off your fat fucking ass and give us what we want! no one cares? about game station 2.0 The video? was ... By: StanMarsh02. on 22 Apr 12, 15:55:20 The video? was published the 09/04/2012 ? WTH? my head hurts... Can anyone? tell me ... By: LiquidArmProduction. on 30 Sep 11, 13:57:15 Can anyone? tell me how much the auction of episode 2 ended at? Can anyone tell me ... By: LiquidArmProduction. on 30 Sep 11, 13:57:12 Can anyone tell me how much the auction of episode 2 ended at?? My heart skipped a? ... By: ibelieveihadahat. on 20 Feb 11, 07:23:18 My heart skipped a? beat when he almost grabbed Kingdom of the Crystal Skull Does Mr. Plinkett ... By: illustriouschin. on 18 Jan 11, 22:01:35 Does Mr. Plinkett have the immeasurable cajonés to continue reviewing now that he? has jumped the shark? What movie could possibly live up to the hype leading up to The Episode III review? What I say! How'd u take a? ... By: CarlAxelBo. on 09 Jan 11, 23:54:55 How'd u take a? pictr OF UR OWN ASS! HOW'D YOU TAKE A? ... By: SMfan199. on 26 Dec 10, 05:15:53 HOW'D YOU TAKE A? PICTURE OF YOUR OWN ASS!!??? You? can help me ... By: terratrema. on 15 Dec 10, 21:01:41 You? can help me milk my cat. "Meaaaaaaa--" If he's going to ... By: Bassbait. on 04 Nov 10, 05:30:59 If he's going to review something, it has to be something that? REALLY affects Mike Stoklasa, and not just Plinkett. His great reviews rely on being heart-felt as well as heartless to have the magic they do. Does this guy do? ... By: evilkneil67. on 24 Oct 10, 23:05:42 Does this guy do? Zoidbergs voice? You know, I really ... By: DrewBludd. on 12 Oct 10, 17:35:18 You know, I really enjoy these reviews.? I mean, its super insightful, accurate stuff cloaked in a hilarious character. 11 people didn't ... By: Fredcheesburger. on 03 Oct 10, 03:00:48 11 people didn't get their pizza? rolls. i went on there? to ... By: vreeland17. on 02 Oct 10, 15:56:10 i went on there? to subscribe and saw some of those and was like what the fuck! Ugh, don't tease us ... By: busterbox. on 25 Sep 10, 18:49:23 Ugh, don't tease us by showing the second and third Matrix installments and then? not eviscerate them. Please, you must review them. It's a matter of basic justice. I want a pizza Role ... By: Jarinabigbox. on 07 Sep 10, 00:27:40 I want a pizza Role ? Well, partially ... By: evilmiera. on 06 Sep 10, 04:57:33 Well, partially that and partially just bad film-making skills in general, the whole strike thing occuring at the start of filming and him just rolling with it... but yes, I think the point I realized what a horrible movie it was basically came around when that execution did. Mainly because it's so out of character, but also because? the enemy just made a statement of a coming attack and instead of interrogating the guy, he gets shot point blank? Yes, indeed, The ... By: Relugus. on 06 Sep 10, 01:03:33 Yes, indeed, The core reason the TF movies, especially 2, are bad, stems? from the fact that Bay has no respect or understanding of the source material. The biggest problem with the TF movies is the TFs not being the main characters, and Bay not grasping the fact that they are sentient robots (including the "bad guys"). I think Plinkett would especially rip the scene where Prime kills a Decep in cold blood in TF2. Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18   You like it? Share it! Social Bookmarking

Iphone apps videos :: Videos are copyright their respective owners :: Feedback powered by: Customer Feedback