 |
The funniest moments from everyone's favorite movie reviewer, RedLetterMedia's Harry ...
Posted by: JediFan421
Video duration: 864 seconds
Global video hits: 18241
The funniest moments from everyone's favorite movie reviewer, RedLetterMedia's Harry S. Plinkett, voiced by Mike Stoklasa and portrayed by Rich Evans. All material produced at redlettermedia.com
Related: redlettermedia, harry, plinkett, star, wars, review, the, phantom, menace, attack, of, clones, revenge, sith, babys, day, out, trek, mike, stoklasa, rich, evans, jedi, darth, vader, clone, lightsaber, force
Display Video Comments | Hide Video Comments | Add Comment
|
|
 |
Mr. Plinkett: animated series #1
Posted by: 789Films789
Video duration: 163 seconds
Global video hits: 37768
For Mike Stoklasa of Redlettermedia and the (fingerscrossed) public domain/un-copyrighte d Harry S. Plinkett. Star Wars Blu-ray coming to a store near you= can't wait! 789films789. Adventures of the Blue Car. Half in the Bag. Star Trek the next generation.
Related: redlettermedia, adventures of the blue car, animated, cartoon, mr. plinkett, nadine, mike stoklasa, review, new, half in the bag, justin bieber, tyt, coast to coast am
Display Video Comments | Hide Video Comments | Add Comment
|
|
 |
Dear Mr. Plinkett...
Posted by: mark84j
Video duration: 108 seconds
Global video hits: 7935
A letter to my favorite internet reviewer.
Related: red, letter, media, mr, mister, plinkett, star, wars, review, attack, of, the, clones, phantom, menace, thank, you, sir
Display Video Comments | Hide Video Comments | Add Comment
|
|
 |
Plinkett's NEW Review is up nao!
Posted by: RedLetterMedia
Video duration: 104 seconds
Global video hits: 86161
www.redlettermedia.c om - COP DOG!!! See Plinkett dismantle the worlds most favoritests movie about a ghost cop dog
Related: red, letter, media, plinkett, cop, dog, star, wars, reviews, harry, s.
Display Video Comments | Hide Video Comments | Add Comment
|
|
 |
Merry Christmas, Mr. Plinkett
Posted by: Cartoonamations
Video duration: 197 seconds
Global video hits: 9961
Mr. Plinkett: animated series #3 On behalf of all of your fans- may all your Christmases be white, Mr. Plinkett and Redlettermedia. Star Wars Review. george lucus. Mike Stoklasa. Half in the Bag. 789films789. Adventures of the Blue Car. Cartoonamations. Jordie Clock.
Related: mr. plinkett, cartoon, animated, review, redlettermedia, 789films, cartoonamations, mike stoklasa, half in the bag, new review
Display Video Comments | Hide Video Comments | Add Comment
|
|
 |
Harry S Plinkett Amigurumi doll
Posted by: pigeonweed
Video duration: 12 seconds
Global video hits: 4588
Harry S Plinkett is a character by Mike Stoklasa from Red Letter Media (www.redlettermedia. com) He comes with accessories. More details here periwinkleimp.devian tart.com
Related: harry, plinkett, nadine, star, wars, prequel, review, mike, stoklasa, red, letter, media, ooak, amigurumi, crochet, doll, playset, action, figure, toy
Display Video Comments | Hide Video Comments | Add Comment
|
|
 |
STOP PLINKETT 2012
Posted by: Cartoonamations
Video duration: 337 seconds
Global video hits: 7895
a fan-made tribute to Harry S. Plinkett. Mike Stoklasa and RedLetterMedia have been good sports for tolerating these rip-offs... err.. homages. Mr. Plinkett Animated Series #4. Titanic. 100 years. Sinking. Star Wars. Star Trek Next Gen. TNG. Kony 2012. Gamestation 2.0. Cartoonamations. 789films789. Shaun McKinnon.
Related: mr. plinkett, cartoonamations, animated series, titanic, kony, redlettermedia, half in the bag, mike stoklasa, tng, gamestation 2.0, star wars review, animation, space cop
Display Video Comments | Hide Video Comments | Add Comment
|
|
 |
Mr. Plinkett is going to microwave his cat!
Posted by: CharlesP2009
Video duration: 25 seconds
Global video hits: 14450
Most of my buddies missed this clip from the very end of Red Letter Media's Star Wars Episode III Review Epilogue, Revenge of Nadine, so I decided to upload it here. Mr. Plinkett is about to microwave something he shouldn't!
Related: red, letter, media, mr., harry, s., plinkett, star, wars, episode, iii, revenge, of, the, sith, review, microwave, microwaveable, cat, kitty, felis, catus, not, meat, cathicken, pizza, rolls, worst, movie, ever, craigslist, trek, nadine, charlie, and, chocolate, factory, come, with, me, youll, be, in, world, pure, imagination, take, look, see, into, your, well, begin, spin, traveling, my, creation, what, will, defy, explanation
Display Video Comments | Hide Video Comments | Add Comment
|
|
|
|
You like it? Share it!
Social Bookmarking 
|
Latest comments made on this video:
By: SuperHeroMania. on 23 May 12, 03:47:45
I was disappointed he though Star Trek First Contact was bad, that was the only film I disagreed with? him
By: superstarmc1. on 20 May 12, 21:17:32
Euyuyujjtggyyyyuhhyyyiuyyyyyuyyttptttytpppppyoprpppppprrrpppppppprppplfllppordrooorogopsddufdgxgupprggohfkklllllllppppooopyrrllpplipqlllllallllpplwrppptaafafafryroptlyutyhlkiiiitrfdhffdfff?
By: halo6534. on 20 May 12, 08:30:31
I wasn't yelling at? you.....i know what your comment ment. I was just telling you my opinion on it.
By: KLADDKAKA1985. on 20 May 12, 01:19:38
Did I say I liked it? I just told you that he did a positive review about avatar. Keep your? adhd in check.
By: halo6534. on 19 May 12, 10:57:04
Avatar? was such a gay, retarded, overrated piece of shit. Never before had i watched such a CLICHE, PREDICTABLE, BORING, UNINSPIRED, BAD CASTED movie. Grossing almost 3 billion dollars, i was expecting a masterpiece, but got a shitsterpiece.
By: The1AndOnlyDannyBro. on 17 May 12, 04:54:01
Gay voiced plinkett is the best? plinkett.
By: darthzach. on 09 May 12, 09:45:31
Browns and? BEIIIGE!
By: satsunada. on 04 May 12, 11:41:52
And Rick Astley, and Rick Rude, and Ric Flair, and Rickets,? and Rick Moranis, and Rick Hoffman
By: SeeYouNextTuesday0. on 03 May 12, 23:08:41
Brown and Beiggggge.?
By: LondonCrusader. on 03 May 12, 03:22:21
59 minutes? !!!!
By: The1AndOnlyDannyBro. on 30 Apr 12, 05:16:20
Hey, remember that scene in SW Episode three, after they save Palpatine, Anakin says something about saving Ben for the 10th time, and Ben says 9th time? He a really awkward line and shifty eyes when saying that other stuff doesn't count. Everytime I see this? scene, I think of that scene in Pulp Fiction. You know, the one with that black guy and the thing is his mouth while he's getting... *cough*... and that guy walks in with a sword and... Yeah. I think that's what happened.
By: BlarkUntVhite. on 22 Apr 12, 12:22:50
Fifffty niiine minnnuuuuutes~ ? (?____?)
By: Cgrazi18. on 20 Apr 12, 01:02:37
What's the name of this guys channel?
By: KLADDKAKA1985. on 17 Apr 12, 05:21:33
He, didnt seem to mind avatar.?
By: JediFan421. on 13 Apr 12, 14:27:50
I'm going to do a best of Rich Evans including his Plinkett stuff soon. ?
By: nsomestuph. on 13 Apr 12, 07:37:07
I was expecting all of the plinket? videos into one but this will do i guess.
By: Feratrox. on 10 Apr 12, 17:18:21
Making a best of Plinkett seems impossible since there's just so much great stuff he's done. You pretty much nailed it though, except for the ending to his Phantom Menace review about the scene he found to be the strangest.... You all? saw that right?
By: silarnon. on 08 Apr 12, 09:59:32
Which fired a little ball of light which? ... went off like a teeny fire cracker. What the fuck? The phasers small enough to fit into your hand can EVAPORATE AN ENTIRE PERSON. And a BAZOOKA only explodes an itty bitty rock?!?! FUCK.
By: Jay21L. on 07 Apr 12, 11:37:27
how did you? get the episode III review clips?
By: behrooz4. on 02 Apr 12, 03:18:51
So then Worf had a purple? space bazooka...
By: Buffalodriver87. on 31 Mar 12, 23:07:51
you may have heard of it, it was this? little thing called WORLD WAR ONE!!!
By: richardmoores. on 28 Mar 12, 12:58:04
My name's Rick, and I? ruin everything too!
By: jmiester25. on 27 Mar 12, 16:02:56
yeah Astley is actually good? at what he does hahah :p
By: JediFan421. on 26 Mar 12, 21:29:58
He only? reviews bad movies though... (except for Star Trek 2009)
By: najsbajsmedmajs. on 26 Mar 12, 19:40:56
i vvant him to do? a pulp fiction revvievv!